Analytical Data
-
Gene name
TMX3
- Application
-
Alternative Names
TMX3；KIAA1830；TXNDC10；Protein disulfide-isomerase TMX3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96JJ7
-
Expression Region
25-195aa
-
AA Sequence
KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMX3 (Transmembrane Protein 3) is a protein that belongs to the TMX family, which is known for its roles in protein folding, quality control, and cellular stress responses. Research has indicated that TMX3 may play a critical role in the endoplasmic reticulum (ER) by participating in the regulation of oxidative stress and the maintenance of redox balance within cells. Studies have shown that TMX3 is involved in various cellular processes, including the modulation of reactive oxygen species (ROS) levels and the enhancement of protein stability under stress conditions. Additionally, TMX3 has been implicated in several pathophysiological conditions, including cancer and neurodegenerative diseases, suggesting its potential as a biomarker or therapeutic target. The recombinant expression of TMX3 allows for detailed investigations into its structure-function relationships and functional interactions within the cellular environment. Understanding the mechanism by which TMX3 operates could lead to novel strategies for developing interventions in diseases where oxidative stress and protein misfolding are prominent factors. Therefore, studying the recombinant TMX3 protein may provide valuable insights into its physiological roles and therapeutic applications, making it a significant focus of current biomedical research.
