Analytical Data
-
Gene name
SUCLG2
- Application
-
Alternative Names
SUCLG2；Succinate--CoA ligase [GDP-forming] subunit beta. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96I99
-
Expression Region
49-423aa
-
AA Sequence
MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAK
-
Molecular Weight
56.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
SUCLG2 (Succinate-CoA ligase, GDP-forming beta subunit) is a mitochondrial enzyme crucial for energy metabolism, specifically in the context of succinate utilization. As a part of the succinate-CoA ligase complex, SUCLG2 plays an integral role in the citric acid cycle, facilitating the conversion of succinate to succinyl-CoA while generating GTP from GDP. Alterations in the function or expression of SUCLG2 have been linked to various metabolic disorders and certain types of cancer, highlighting its potential as a therapeutic target. Research into the structural and functional properties of SUCLG2, including the development of recombinant protein, is essential for understanding its role in mitochondrial metabolism and energy homeostasis. Through techniques such as site-directed mutagenesis and protein crystallization, scientists aim to elucidate the molecular mechanisms governing its activity. This foundational knowledge could pave the way for the design of novel interventions to modulate SUCLG2’s function in disease contexts, emphasizing its importance in bioenergetics and metabolic regulation. Furthermore, the production of recombinant SUCLG2 offers opportunities for high-throughput screening of small molecules that could enhance or inhibit its activity, thus providing a valuable platform for drug discovery and the development of metabolic therapies.
