Analytical Data
-
Gene name
PLEKHB2
- Application
-
Alternative Names
PLEKHB2；EVT2；Pleckstrin homology domain-containing family B member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96CS7
-
Expression Region
1-222aa
-
AA Sequence
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLEKHB2, a member of the pleckstrin homology domain-containing protein family, has garnered significant attention due to its potential role in various cellular processes, including immune response and inflammation. Recent studies suggest that PLEKHB2 is implicated in the regulation of macrophage polarization and may influence cancer progression and autoimmune diseases. Understanding the function of PLEKHB2 is crucial for elucidating its contributions to disease mechanisms and could pave the way for novel therapeutic strategies. Recombinant PLEKHB2 protein has been produced for in vitro studies to explore its biochemical properties and interactions with other proteins. By investigating this recombinant protein, researchers aim to define its structural characteristics, binding affinities, and functional roles in cellular signaling pathways. This research not only enhances our understanding of PLEKHB2's involvement in physiological and pathological conditions but also holds promise for its application in drug development and targeted therapies.
