Analytical Data
-
Gene name
CXorf58
- Application
-
Alternative Names
CXorf58Putative uncharacterized protein CXorf58
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LI9
-
Expression Region
1-332aa
-
AA Sequence
MNRSSNVPRKGILKSGTRSLQKVCRVHFANARNARSLLSMLKDISAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEMKFLLQRPVTQEIHKHQLRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF
-
Molecular Weight
36.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXorf58, also known as "Chromosome X Open Reading Frame 58," has emerged as a protein of interest in various research fields due to its potential roles in cell biology and disease mechanisms. Located on the X chromosome, CXorf58 is thought to be involved in critical cellular processes, including cell proliferation, differentiation, and apoptosis. Studies have suggested that CXorf58 may have implications in cancer, particularly in how it interacts with other proteins in signaling pathways. Its expression patterns and functional roles, however, remain poorly characterized, necessitating further investigation into its biological significance. The recombinant production of CXorf58 not only allows for a better understanding of its structure and function but also presents opportunities for exploring its interactions with other cellular components. The ability to study CXorf58 in vitro can facilitate the identification of potential therapeutic targets and the development of diagnostic tools for diseases associated with its dysregulation. Thus, research on CXorf58 is essential for advancing our comprehension of its contributions to health and disease, opening new avenues for biomedical research and therapeutic advancements.
