Analytical Data
-
Gene name
SLC39A5
- Application
-
Alternative Names
SLC39A5; ZIP5; Zinc transporter ZIP5; Solute carrier family 39 member 5; Zrt- and Irt-like protein 5; ZIP-5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZMH5
-
Expression Region
21-539 aa
-
AA Sequence
VGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG
-
Molecular Weight
82.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC39A5, also known as ZIP5, is a member of the SLC39 family of zinc transporters, which play critical roles in cellular zinc homeostasis and are implicated in various physiological and pathological processes. Zinc is an essential trace element that is crucial for numerous biological functions, including enzyme activity, protein synthesis, and cell signaling. Dysregulation of zinc transporters, including SLC39A5, has been associated with several disorders, such as neurodegenerative diseases, cancer, and immune dysfunction. Research into the recombinant protein of SLC39A5 is vital for understanding its functional mechanisms and regulatory pathways. By producing and characterizing this recombinant protein, scientists aim to elucidate its role in zinc transport and intracellular signaling, as well as its potential interactions with other cellular proteins. Furthermore, studying SLC39A5 can provide insights into the molecular basis of diseases related to zinc deficiency or overload, paving the way for novel therapeutic approaches. Overall, SLC39A5 remains a promising target for research that bridges the fields of molecular biology, biochemistry, and medicine, emphasizing the significance of zinc homeostasis in health and disease.
