Analytical Data
-
Gene name
CXorf41
- Application
-
Alternative Names
PIH1D3; CXorf41; Protein PIH1D3; PIH1 domain-containing protein 3; Sarcoma antigen NY-SAR-97
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQM4
-
Expression Region
1-214aa
-
AA Sequence
MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF
-
Molecular Weight
50.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXorf41, a gene located on the X chromosome, has garnered attention in recent years due to its potential roles in various biological processes and diseases. Initially implicated in X-linked genetic disorders, research has illuminated its involvement in cellular pathways related to growth, differentiation, and immune response. The protein encoded by CXorf41 remains relatively understudied, but emerging evidence suggests that it may interact with key signaling molecules, thus influencing pathological conditions like cancer and autoimmune diseases. Recombinant CXorf41 protein production is pivotal for further elucidating its functional roles and mechanisms of action. By utilizing techniques such as recombinant DNA technology, researchers aim to produce large quantities of this protein, enabling extensive biochemical assays and structural analyses. Understanding the properties and interactions of CXorf41 at the molecular level could reveal novel therapeutic targets and biomarkers, advancing the field of personalized medicine and providing insights into the intricate workings of X-linked genetic regulation. As the scientific community seeks to comprehend the significance of CXorf41 in health and disease, the development of robust experimental models will be crucial for uncovering its potential biological implications.
