Analytical Data
-
Gene name
CXorf12
- Application
-
Alternative Names
TMEM187; CXorf12; DXS9878E; ITBA1; Transmembrane protein 187; Protein ITBA1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14656
-
Expression Region
1-261aa
-
AA Sequence
MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR
-
Molecular Weight
54.45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXorf12, also known as CXORF12 or C8orf12, encodes a protein that is of significant interest due to its potential roles in various biological processes and disease mechanisms. Research has indicated that CXorf12 may be implicated in cellular functions such as protein-protein interactions, signal transduction pathways, and possibly even in the development of certain cancers. The protein's expression and regulation are still being studied to understand its functional role in health and disease. Notably, the exploration of CXorf12 recombinant proteins has emerged as a crucial approach to elucidate its structure and function, which can provide insights into its involvement in pathophysiological conditions. The generation of CXorf12 recombinant proteins allows researchers to perform detailed biochemical assays, structural biology studies, and functional analyses, ultimately aiming to identify potential biomarkers or therapeutic targets. Moreover, understanding the interactions and mechanisms associated with CXorf12 could have implications for developing strategies to combat diseases where this protein plays a critical role. Thus, ongoing studies focused on the isolation and characterization of CXorf12 recombinant proteins are pivotal in advancing our knowledge of its biological significance and therapeutic potential.
