Analytical Data
-
Gene name
SLC35E4
- Application
-
Alternative Names
SLC35E4; Solute carrier family 35 member E4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ICL7
-
Expression Region
1-234 aa
-
AA Sequence
MCRCPPEHHDGRMTSAEVGAAAGGAQAAGPPEWPPGSPQALRQPGRARVAMAALVWLLAGASMSSLNKWIFTVHGFGRPLLLSALHMLVAALACHRGARRPMPGGTRCRVLLLSLTFGTSMACGNVGLRAVPLDLAQLVTTTTPLFTLALSALLLGRRHHPLQLAAMGPLCLGAACSLAGEFRTPPTGCGFLLAATCLRGLKSVQQSLSFQICKMELMIPMERVRMRSAGQGQE
-
Molecular Weight
51.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35E4 is a member of the solute carrier (SLC) family, which plays a crucial role in the transport of various metabolites and ions across cellular membranes. Its potential involvement in cellular processes such as nucleotide transport, cell signaling, and immune response has drawn considerable attention from researchers. Recent studies have indicated that mutations in the SLC35E4 gene may be associated with certain diseases, highlighting the importance of this protein in maintaining cellular homeostasis and overall health. The recombinant expression of SLC35E4 allows for in-depth analysis of its structural and functional properties, providing insights into its role in cellular transport mechanisms. Using advanced techniques such as crystallography and functional assays, researchers aim to elucidate the molecular basis of SLC35E4-mediated transport, explore its interactions with other cellular components, and investigate its potential as a therapeutic target. Understanding the function of SLC35E4 is not only vital for depicting the full picture of transport processes in cells but also has implications for the development of novel treatments for diseases related to its dysfunction. This makes the study of SLC35E4 recombinant protein not only significant from a basic science perspective but also relevant for translational research aimed at improving human health.
