Analytical Data
-
Gene name
DYDC2
- Application
-
Alternative Names
DYDC2;DPY30 domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96IM9
-
Expression Region
1-177aa
-
AA Sequence
METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF
-
Molecular Weight
36.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DYDC2, a member of the DYDC protein family, has garnered significant interest in recent years due to its potential implications in various biological processes and diseases. Research indicates that DYDC2 may play a role in cellular stress responses, apoptosis, and signal transduction pathways, making it a candidate for further exploration in cancer and neurodegenerative diseases. The protein's unique structure, characterized by a conserved domain, suggests its involvement in protein-protein interactions and cellular localization. Current studies aim to elucidate the functional mechanisms of DYDC2 through recombinant protein expression and purification techniques, allowing researchers to analyze its biochemical properties and biological roles in detail. Understanding the significance of DYDC2 could pave the way for novel therapeutic strategies targeting related pathways, highlighting the importance of this protein in both basic and applied biomedical research.











