Analytical Data
-
Gene name
CT45A3
- Application
-
Alternative Names
CT45A3; CT45-3; CT45-4; CT45A4Cancer/testis antigen family 45 member A3; Cancer/testis antigen 45-3; Cancer/testis antigen 45-4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHU0
-
Expression Region
1-189aa
-
AA Sequence
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
-
Molecular Weight
47.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CT45A3 is a cancer/testis (CT) antigen that has gained significant attention in the field of cancer immunology due to its restricted expression pattern and potential as a target for immunotherapy. CT antigens are normally expressed in the germ cells of the testes but are aberrantly activated in various malignancies, making them ideal candidates for cancer immunotherapy because they can elicit an immune response without affecting normal tissues. CT45A3, in particular, has been identified in several types of cancers, including melanoma and prostate cancer, where its expression correlates with tumor progression. Previous studies have highlighted its potential role in promoting cancer cell proliferation and survival, thus establishing CT45A3 as a novel biomarker for tumor detection. Researchers are investigating the mechanisms of CT45A3 expression in tumors, the immune responses it triggers, and its utility in diagnostic and therapeutic applications. Given the growing focus on personalized medicine, the elucidation of CT45A3's role in various cancers could lead to the development of targeted therapies and vaccines that harness the immune system to recognize and eliminate tumor cells, offering hope for improved treatment options for patients with cancer.
