Analytical Data
-
Gene name
CT45-6
- Application
-
Alternative Names
Cancer/testis antigen family 45 member A6. Cancer/testis antigen 45-6. Cancer/testis antigen 45A6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DMU7
-
Expression Region
1-189aa
-
AA Sequence
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
-
Molecular Weight
47.19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CT45-6 is a member of the CT (cancer/testis) antigen family, which is primarily expressed in human gonads and various tumors, making it a significant target for cancer immunotherapy. The CT antigens are unique because they are normally absent in most somatic tissues but are expressed in some tumor cells, leading to significant interest in their potential for use as biomarkers and targets for therapeutic interventions. Research has shown that CT45-6 is upregulated in several malignancies, including lung cancer and melanoma, suggesting its role in tumorigenesis and development. Given its restricted expression pattern and immunogenic properties, CT45-6 presents a promising candidate for vaccine development and personalized cancer treatments. Understanding its molecular characteristics, expression profiles, and mechanisms of immune evasion could enhance the design of immunotherapeutic strategies. Current studies are focusing on elucidating the role of CT45-6 in tumor microenvironments and its potential to elicit robust immune responses, paving the way for innovative cancer treatments that leverage the body's own immune system to target and destroy tumor cells while minimizing damage to normal tissues.
