Analytical Data
-
Gene name
SLC25A16
- Application
-
Alternative Names
SLC25A16; GDA; Graves disease carrier protein; GDC; Graves disease autoantigen; Mitochondrial solute carrier protein homolog; Solute carrier family 25 member 16
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16260
-
Expression Region
1-332 aa
-
AA Sequence
MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN
-
Molecular Weight
62.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A16, a member of the solute carrier family 25, encodes a mitochondrial transporter involved in the exchange of metabolites across the inner mitochondrial membrane. Recent studies have highlighted its critical role in cellular metabolism, particularly in the transport of acylcarnitines and amino acids essential for fatty acid oxidation and energy production. Dysregulation or mutations within SLC25A16 have been associated with metabolic disorders, including mitochondrial diseases, that can lead to compromised energy homeostasis and various health complications. The recombinant expression and characterization of SLC25A16 protein have garnered significant interest within the scientific community, as these studies facilitate a better understanding of its function and mechanisms. By producing purified SLC25A16 in suitable expression systems, researchers aim to investigate its transport properties, substrate specificity, and functional interactions with other mitochondrial proteins. This research not only contributes to foundational knowledge of mitochondrial transport processes but also has implications for potential therapeutic targets in metabolic diseases. Moreover, understanding the functional dynamics of SLC25A16 can provide insights into the development of interventions aimed at restoring normal mitochondrial function and improving metabolic health. Overall, the study of SLC25A16 recombinant protein is a vital step towards unraveling the complexities of mitochondrial transport mechanisms and their impact on human health.
