Analytical Data
-
Gene name
CRSP8
- Application
-
Alternative Names
Cofactor required for Sp1 transcriptional activation subunit 8 (34kD); Cofactor required for Sp1 transcriptional activation subunit 8 34kDa; Cofactor required for Sp1 transcriptional activation subunit 8; CRAP 34; CRAP34; CRSP 34; CRSP 8; CRSP complex subunit 8; CRSP34; CRSP8; MED 27
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P2C8
-
Expression Region
1-70aa
-
AA Sequence
MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
-
Molecular Weight
33.44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRSP8, a member of the complex that regulates steroid hormone receptor activities, plays a pivotal role in various cellular processes, including transcriptional regulation. Research into CRSP8 has gained momentum due to its involvement in critical biological functions and its potential implications in disease pathways, particularly in cancer and metabolic disorders. The transcriptional coactivator's ability to interact with nuclear receptors and influence gene expression highlights its importance in maintaining cellular homeostasis. Studies have focused on delineating the structural and functional properties of CRSP8, as well as its interactions with other key proteins in the transcriptional machinery. This research is crucial for understanding the mechanisms of hormonal regulation and the development of therapeutics targeting CRSP8-mediated pathways. With advancements in molecular biology techniques, the characterization of CRSP8 and its associated complexes is expected to yield insights into the molecular underpinnings of diseases, paving the way for innovative approaches in the treatment and prevention of hormone-related conditions.
