Analytical Data
-
Gene name
Bcl11A
- Application
-
Alternative Names
Bcl11A；CTIP1；EVI9；KIAA1809；B-cell lymphoma/leukemia 11A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H165
-
Expression Region
1-88aa
-
AA Sequence
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ CQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Bcl11A, a member of the B-cell lymphoma (Bcl) family of proteins, has garnered significant attention in recent years due to its critical role in hematopoiesis and the regulation of gene expression. Initially identified as a factor implicated in lymphocyte development, Bcl11A functions as a transcriptional repressor that is essential for the maturation of various blood cell lineages, particularly in the transition from fetal to adult hemoglobin. In addition to its role in normal hematopoiesis, aberrant expression of Bcl11A has been linked to several hematological disorders, including leukemia and other malignancies, positioning it as a potential target for therapeutic intervention. Furthermore, studies have indicated that Bcl11A is involved in the epigenetic regulation of gene expression, influencing chromatin structure and accessibility. This regulatory capacity has prompted research into its potential application in gene therapy, particularly for conditions like sickle cell disease and β-thalassemia, where reactivation of fetal hemoglobin production may provide therapeutic benefits. The recombinant Bcl11A protein has been utilized in various in vitro and in vivo studies to elucidate its functional mechanisms and interactions with other regulatory factors within the hematopoietic system. Understanding the precise role of Bcl11A in both normal and pathological contexts continues to be an area of vibrant research, with implications for the development of innovative treatment strategies for blood disorders.
