Analytical Data
-
Gene name
SLC25A14
- Application
-
Alternative Names
SLC25A14; BMCP1; UCP5; UNQ791/PRO1682; Brain mitochondrial carrier protein 1; BMCP-1; Mitochondrial uncoupling protein 5; UCP 5; Solute carrier family 25 member 14
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95258
-
Expression Region
1-325 aa
-
AA Sequence
MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI
-
Molecular Weight
62.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The SLC25A14 gene encodes a member of the solute carrier family of proteins, specifically acting as a mitochondrial transporter for certain metabolites, including nucleotides and organic acids. Research into SLC25A14 has gained importance due to its role in crucial cellular processes such as energy metabolism and mitochondrial function. Mutations in this gene have been linked to various metabolic disorders, including mitochondrial diseases, which can lead to severe health complications. By investigating the recombinant protein of SLC25A14, researchers aim to elucidate its specific functions and transport mechanisms, potentially revealing insights into disease pathogenesis. Understanding the structure and activity of SLC25A14 can pave the way for developing therapeutic strategies targeting mitochondrial dysfunction. Furthermore, the expression and characterization of recombinant SLC25A14 provide a vital tool for studying its interactions with substrates and other cellular components, enhancing our understanding of mitochondrial biology and its implications in human health. This research may also contribute to advancing diagnostic and treatment approaches for conditions stemming from SLC25A14 dysfunction.
