Analytical Data
-
Gene name
SLC25A11
- Application
-
Alternative Names
SLC25A11; SLC20A4; Mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Solute carrier family 25 member 11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02978
-
Expression Region
1-314 aa
-
AA Sequence
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG
-
Molecular Weight
60.28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A11, part of the solute carrier family, encodes a mitochondrial transporter responsible for the exchange of aspartate and glutamate across the inner mitochondrial membrane. This protein plays a crucial role in cellular metabolism, particularly in amino acid metabolism and energy production. Dysregulation or mutations in SLC25A11 have been linked to various metabolic disorders and neurodegenerative diseases, highlighting its importance in cellular function and health. Research into SLC25A11 recombinant proteins has gained traction as scientists aim to elucidate its structural and functional characteristics, allowing for a better understanding of its role in mitochondrial dynamics and neurotransmitter regulation. The production of recombinant SLC25A11 provides a valuable tool for in vitro studies, enabling the analysis of transporter activity, substrate specificity, and the impact of potential pharmacological agents. With advances in protein engineering and expression systems, detailed investigations of SLC25A11 can pave the way for therapeutic interventions targeting mitochondrial dysfunction associated with several diseases. Further studies will not only enhance our understanding of the metabolism and physiology mediated by SLC25A11 but also open avenues for potential drug development aimed at restoring normal transporter function in pathological conditions. This research is vital for deciphering the complexities of mitochondrial metabolism and its implications for overall cellular health and disease mechanisms.
