Analytical Data
-
Gene name
CRKRS
- Application
-
Alternative Names
arginine/serine-rich; Cdc2 related kinase arginine/serine rich; CDC2 related protein kinase 7; Cdc2-related kinase; CDC2-related protein kinase 7; Cdk12; CDK12_HUMAN; Cell division cycle 2 related protein kinase 7; Cell division cycle 2-related protein kinase 7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYV4
-
Expression Region
1281-1380aa
-
AA Sequence
LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRKRS, or Cysteine-Rich Protein Kinase Regulated by Stress, has garnered significant attention in recent years due to its critical role in cellular response to stress and its potential implications in various diseases, including cancer and neurodegenerative disorders. As a member of the protein kinase family, CRKRS is involved in various signaling pathways that regulate cellular activities such as proliferation, differentiation, and apoptosis. Research has shown that CRKRS expression levels can be influenced by various stressors, including oxidative stress, hypoxia, and nutrient deprivation, leading to its involvement in cellular adaptation mechanisms. Understanding the structure and functional mechanisms of CRKRS is vital for unraveling its role in stress response pathways and identifying potential therapeutic targets for diseases where these pathways are dysregulated. Recent advances in recombinant protein technology have enabled the production of CRKRS in a laboratory setting, facilitating detailed studies on its biochemical properties and interactions with other cellular components. By generating and characterizing CRKRS recombinant proteins, researchers aim to elucidate the protein's structure-function relationships and its regulatory mechanisms, paving the way for novel strategies in disease intervention and treatment. This research not only enhances our fundamental understanding of cellular responses to stress but also holds the promise of translating basic science into innovative therapeutic approaches for improving human health.











