Analytical Data
-
Gene name
COX6B1
- Application
-
Alternative Names
COX 6B; COX VIb 1; COX VIb-1; COX6B; COX6B1; COXG; COXVIb1; CX6B1_HUMAN; Cytochrome c oxidase subunit 6B1; Cytochrome c oxidase subunit VIb; Cytochrome c oxidase subunit VIb isoform 1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); Cytochrome c oxidase subunit Vib polypeptide 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14854
-
Expression Region
1-86aa
-
AA Sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cox6b1 is a crucial gene encoding a subunit of cytochrome c oxidase (CCO), the terminal enzyme of the mitochondrial electron transport chain, playing a pivotal role in cellular energy production via oxidative phosphorylation. Genetic mutations in COX6B1 have been linked to various mitochondrial disorders, which can manifest in a range of symptoms affecting multiple organ systems, particularly in muscle and neural tissues. The study of recombinant Cox6b1 protein aims to elucidate the structural and functional properties of this subunit, providing insights into its role in CCO assembly and activity. Recombinant protein studies facilitate the understanding of disease mechanisms associated with COX6B1 mutations and pave the way for potential therapeutic interventions. By investigating the biochemical characteristics and interaction networks of Cox6b1, researchers seek to develop novel approaches to diagnose and treat mitochondrial diseases, further contributing to the wider field of mitochondrial biology and genetic research. Understanding the function of Cox6B1 at a molecular level not only enhances our knowledge of mitochondrial physiology but also holds potential for developing targeted therapies for associated mitochondrial pathologies.
