Analytical Data
-
Gene name
COX6A1
- Application
-
Alternative Names
COX VIa L; COX VIa-L; COX6A; COX6A1; COX6AL; CX6A1_HUMAN; Cytochrome c oxidase polypeptide VIa liver; Cytochrome c oxidase polypeptide VIa-liver; Cytochrome c oxidase subunit 6A1; Cytochrome c oxidase subunit 6A1 mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12074
-
Expression Region
1-109aa
-
AA Sequence
MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX6A1, a subunit of cytochrome c oxidase (COX), plays a crucial role in mitochondrial respiratory function and energy production. As a key component of the electron transport chain, COX6A1 is involved in the enzymatic reduction of oxygen to water while facilitating the transfer of protons across the mitochondrial membrane, which is essential for ATP synthesis. Research on COX6A1 has gained significance due to its implications in various diseases, including mitochondrial disorders and cancers, where dysregulation of mitochondrial function is evident. The recombinant protein expression of COX6A1 allows for detailed biochemical studies and functional assays, enabling researchers to better understand its structure-function relationships. Additionally, the availability of recombinant COX6A1 facilitates the development of therapeutic strategies aimed at restoring defective mitochondrial function. Recent advancements in protein engineering and expression systems have made it possible to produce high yields of pure COX6A1, providing a valuable tool for investigating its role in cellular respiration and its potential as a biomarker for mitochondrial dysfunction. Overall, the study of recombinant COX6A1 not only enhances our understanding of mitochondrial biology but also opens avenues for novel therapeutic interventions in diseases linked to mitochondrial impairments.
