Analytical Data
-
Gene name
COX11
- Application
-
Alternative Names
COX11; COX11 homolog; COX11 homolog; cytochrome c oxidase assembly protein (yeast) ; COX11_HUMAN; COX11P; Cytochrome c oxidase assembly protein COX11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6N1
-
Expression Region
1-276aa
-
AA Sequence
MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
-
Molecular Weight
57.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX11 is a vital protein involved in the assembly and functioning of cytochrome c oxidase (CCO), a key enzyme in the mitochondrial respiratory chain responsible for ATP production. The study of COX11 has gained importance due to its role in cellular energy metabolism and its implications in various diseases, particularly those related to mitochondrial dysfunction. Research has shown that COX11 is crucial for the insertion of copper ions into CCO, a process essential for the enzyme's activity. Mutations in the COX11 gene can lead to impaired cellular respiration and are associated with mitochondrial diseases, highlighting the need for a deeper understanding of its structure and function. Recombinant COX11 proteins have been produced in various model organisms to facilitate this research, enabling scientists to elucidate the molecular mechanisms governing CCO assembly and activity. By exploring the dynamics of COX11 and its interactions with other assembly factors, researchers aim to develop therapeutic strategies for diseases linked to mitochondrial disorders, making it a significant focus within the field of molecular and cellular biology.
