Analytical Data
-
Gene name
SIPA1L2
- Application
-
Alternative Names
SIPA1-like protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P2F8
-
Expression Region
595-812 aa
-
AA Sequence
LLKLDEQGLSFQHKIGILYCKAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDNKTDSTGTHSLYTTYKDYELMFHVSTLLPYMPNNRQQLLRKRHIGNDIVTIVFQEPGALPFTPKSIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDL
-
Molecular Weight
31.9 kDa kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIPA1L2 (Signal-Induced Proliferation-associated protein 1-like 2) is a member of the SIPA1 family, known for its role in signal transduction and cellular processes like proliferation and migration. It has gained research interest due to its potential involvement in various pathophysiological conditions, including cancer, neurological disorders, and immune response modulation. The protein is characterized by its ability to interact with small GTPases, influencing signaling pathways such as the Ras and Rho families, which are crucial for cellular functions. Investigation into SIPA1L2's structure and function may reveal novel insights into its regulatory mechanisms and interactions, contributing to our understanding of its role in disease. The development of recombinant SIPA1L2 protein facilitates these studies, allowing for biochemical assays, interaction studies, and potential therapeutic applications targeting the pathways it influences. Overall, understanding SIPA1L2 could provide significant implications for drug development and therapeutic strategies in diseases where its regulation is disrupted.
