Analytical Data
-
Gene name
VASH1
- Application
-
Alternative Names
VASH1；KIAA1036；VASH；Tubulinyl-Tyr carboxypeptidase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L8A9
-
Expression Region
1-204aa
-
AA Sequence
MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
-
Molecular Weight
27.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VASH1 (Vasohibin-1) is an angiogenic factor that plays a crucial role in the regulation of blood vessel formation and maintenance. It was originally identified for its ability to inhibit endothelial cell proliferation and migration, processes essential for angiogenesis. The significance of VASH1 in vascular biology has led to extensive research into its potential roles in various physiological and pathological conditions, including cancer, ischemic diseases, and wound healing. Emerging studies have highlighted its dual functions, not only as an anti-angiogenic protein but also as a promoter of endothelial cell survival and differentiation in specific contexts. Understanding the molecular mechanisms underlying VASH1’s action could provide insights into novel therapeutic strategies for diseases characterized by abnormal angiogenesis. Furthermore, the recombinant expression of VASH1 has enabled researchers to explore its functional properties in controlled environments, facilitating investigations into its interactions with endothelial cells and other cell types. Characterizing VASH1’s structure and function through recombinant protein studies can pave the way for the development of targeted therapies that manipulate angiogenesis for clinical benefit. These efforts underscore the importance of VASH1 as a potential biomarker and therapeutic target in angiogenesis-related diseases.
