Analytical Data
-
Gene name
SIN3B
- Application
-
Alternative Names
SIN3B; KIAA0700; Paired amphipathic helix protein Sin3b; Histone deacetylase complex subunit Sin3b; Transcriptional corepressor Sin3b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75182
-
Expression Region
1-353 aa
-
AA Sequence
MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLTSQENSHNHGDGAEDFKQQVPYKEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLG
-
Molecular Weight
65.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIN3B is a member of the SIN3 (Swi-independent 3) family of proteins, which play crucial roles in gene regulation and chromatin remodeling. It functions as a transcriptional corepressor by interacting with various transcription factors and recruiting histone deacetylases (HDACs) to target genes, thereby leading to a repressive chromatin environment. Research on SIN3B has gained significance due to its implications in various biological processes, including cell cycle regulation, differentiation, and development. Dysregulation of SIN3B expression has been linked to several diseases, particularly cancer, where altered epigenetic regulation contributes to tumorigenesis. Recent studies have focused on elucidating the structural features of SIN3B, its interacting partners, and the molecular mechanisms underlying its repressive functions. Understanding SIN3B's role in normal physiology and disease states may provide insights into potential therapeutic targets for epigenetic interventions. Given the complexity of gene regulation, exploring the dynamics of SIN3B in various cellular contexts remains a critical area of research in molecular biology and medicine.
