Analytical Data
-
Gene name
SIN3A
- Application
-
Alternative Names
AW553200; DKFZP434K2235; FLJ90319; Histone deacetylase complex subunit Sin 3a; Histone deacetylase complex subunit Sin3a; KIAA0700; Kiaa4126; mKIAA4126; Paired amphipathic helix protein Sin 3a; Paired amphipathic helix protein Sin3a; Sin 3a; SIN3 homolog A; SIN3 homolog A transcription regulator (yeast); SIN3 homolog A transcription regulator; SIN3 transcription regulator homolog A; Sin3a; SIN3A protein; SIN3A_HUMAN; Transcriptional co repressor Sin 3A; Transcriptional co repressor Sin3A; Transcriptional corepressor Sin3a; Transcriptional regulator SIN3A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96ST3
-
Expression Region
1-156 aa
-
AA Sequence
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVVFSSFSWVKKFIFSRKYWLQLVGCGGTTSNLRY
-
Molecular Weight
43.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIN3A is a pivotal protein involved in various cellular processes, including transcriptional regulation, cell cycle control, and maintenance of stem cell pluripotency. It functions as a core component of the SIN3 complex, which serves as a co-repressor that interacts with transcription factors to modulate gene expression, particularly in response to developmental cues and environmental stimuli. Recent studies have highlighted SIN3A’s role in epigenetic regulation through its interaction with histone deacetylases, contributing to chromatin remodeling and cellular differentiation. Moreover, aberrations in SIN3A expression have been implicated in multiple diseases, including cancer, where it can influence tumor growth and metastasis. The recombinant expression of SIN3A allows for detailed exploration of its structure and function, providing valuable insights into its regulatory mechanisms. By studying the biochemical properties and interactions of recombinant SIN3A, researchers aim to unveil its potential as a therapeutic target and improve our understanding of its role in health and disease.
