Cat: PA1000-7469

Recombinant Human CASP7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CASP7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CASP7;MCH3;Caspase-7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55210

  • Expression Region

    1-303aa

  • AA Sequence

    MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKT TRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC FRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVI YGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSG PINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILE EHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY FSQHHHHHH

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CASP7, or Caspase-7, is a key member of the cysteine-aspartic protease (caspase) family, which plays a critical role in the execution phase of apoptosis, a programmed cell death essential for maintaining cellular homeostasis and development. The research surrounding CASP7 has gained significant attention due to its involvement in various pathological conditions, including cancer, neurodegenerative diseases, and inflammatory disorders. Unlike other caspases, CASP7 is often regarded as an executioner protease, activating cellular pathways that lead to apoptosis by cleaving specific substrates. The study of recombinant CASP7 proteins is pivotal for understanding its biochemical properties, substrate specificity, and regulatory mechanisms, as well as their implications in disease progression. Recombinant protein technology enables researchers to produce CASP7 in a controlled environment, allowing for detailed investigations into its functional characteristics and interactions with other proteins. Moreover, understanding the structure-function relationship of CASP7 may pave the way for the development of novel therapeutics aimed at modulating its activity in various diseases, particularly in contexts where apoptosis is dysregulated. Therefore, the exploration of CASP7 recombinant proteins is not only critical for basic biological research but also holds promise for advancing therapeutic strategies in apoptosis-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US