Analytical Data
-
Gene name
SH3PXD2A
- Application
-
Alternative Names
SH3PXD2A；FISH；KIAA0418；SH3MD1；SH3 and PX domain-containing Protein 2A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TCZ1
-
Expression Region
902-986aa
-
AA Sequence
PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
-
Molecular Weight
14.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SH3PXD2A (SH3 and PX domains 2A) is a protein that plays a crucial role in cellular processes, particularly in the regulation of cell signaling and endocytosis. This protein is characterized by its SH3 (Src Homology 3) and PX (Phox homology) domains, which are known to mediate protein-protein interactions and membrane trafficking, respectively. Understanding the function of SH3PXD2A is essential for elucidating its involvement in various physiological processes and diseases, including cancer metastasis and immune responses. Previous studies have indicated that SH3PXD2A may influence cytoskeletal dynamics and cellular migration, making it a potential target for therapeutic interventions. The recombinant expression of SH3PXD2A facilitates detailed functional analyses, structural studies, and interaction assays, ultimately contributing to a better understanding of its role in cellular mechanisms. Research on SH3PXD2A is particularly relevant in the context of enhancing our knowledge of complex signaling networks and developing novel strategies for modulating its activity in disease contexts. Overall, SH3PXD2A presents an intriguing subject for further investigation, as insights gained from its study could lead to significant advancements in the fields of cell biology and pharmacology.
