Analytical Data
-
Gene name
COL5A3
- Application
-
Alternative Names
COL5A3Collagen alpha-3(V) chain
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25940
-
Expression Region
157-244aa
-
AA Sequence
EMVTLVADCEAQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPETPRP
-
Molecular Weight
35.42 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL5A3, a member of the collagen type V family, plays a critical role in the structural integrity and functioning of various tissues, particularly in the extracellular matrix (ECM). Research into COL5A3 has gained prominence due to its association with connective tissue disorders, such as Ehlers-Danlos syndrome. Mutations in the COL5A3 gene can lead to abnormal collagen formation, resulting in weakened tissue structure and increased susceptibility to injuries. Understanding the biochemical properties and functions of COL5A3 is essential for developing therapeutic strategies for such disorders. Recombinant COL5A3 protein has been studied for its potential applications in tissue engineering and regenerative medicine, serving as a vital component for scaffold development to support cell growth and differentiation. Furthermore, by elucidating the molecular mechanisms governing collagen assembly and functioning, researchers aim to provide insights into potential interventions for collagen-related diseases. Therefore, exploring the properties of recombinant COL5A3 not only advances our knowledge of collagen biology but also holds promise for clinical applications in managing connective tissue diseases.
