Analytical Data
-
Gene name
Lcn3
- Application
-
Alternative Names
Lcn3；Vomeronasal secretory Protein 1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q62471
-
Expression Region
19-182aa
-
AA Sequence
QDSSFLAFNNGNFSGKWFLKALVSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKTHLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAENLVILEQMEKCEPESFYELPSRPSE
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCN3, or lipocalin 3, is a member of the lipocalin protein family known for its role in various biological processes, including lipid transport, immune response, and cellular signaling. Research on LCN3 has garnered attention due to its involvement in several physiological and pathological conditions, such as inflammation, cancer, and metabolic disorders. The protein is secreted by various cell types and can bind to small hydrophobic molecules, influencing their bioavailability and cellular effects. Studies have shown that LCN3 can modulate the immune response, suggesting its potential as a biomarker for inflammation and a target for therapeutic interventions. The recombinant expression of LCN3 provides a valuable tool for exploring its structure-function relationships and mechanisms of action. By producing LCN3 as a recombinant protein, researchers can conduct detailed studies on its properties and interactions, facilitating the development of potential applications in drug discovery and disease treatment. Understanding the functional roles of LCN3 in various biological contexts can reveal insights into its therapeutic potential and enhance our understanding of related diseases. Thus, the investigation of LCN3 recombinant protein is crucial for advancing biomedical research and developing innovative strategies for disease management.
