Cat: PA2000-3106

Recombinant Serratia hasA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    hasA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    hasA;Hyaluronan synthase

  • Species

    Serratia

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q54450

  • Expression Region

    1-188aa

  • AA Sequence

    MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA

  • Molecular Weight

    35.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of hasA recombinant proteins has gained significant attention in the field of microbiology and biotechnology due to their role in the synthesis of siderophores, which are critical for iron acquisition in various bacterial species, particularly in pathogenic strains. HasA, a hemophore produced by certain bacteria like *Pseudomonas aeruginosa*, facilitates the uptake of heme from host tissues, thus supporting bacterial survival and virulence. Its unique ability to bind heme makes hasA a valuable target for understanding bacterial iron metabolism and developing novel therapeutic strategies to combat infections. Researchers have focused on the recombinant expression of hasA to explore its structure-function relationships, investigate its interaction with host proteins, and evaluate its potential as a vaccine candidate or drug target. The advances in recombinant DNA technology and protein engineering have enabled the production of high quantities of hasA, aiding in comprehensive studies ranging from biochemical characterization to structural analysis. Moreover, understanding the ecological and evolutionary aspects of hasA can provide insights into bacterial adaptation and the development of antibiotic resistance. Overall, the research on hasA recombinant proteins not only enhances our knowledge of bacterial pathogenesis but also paves the way for innovative approaches in medical and environmental applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US