Analytical Data
-
Gene name
RALGPS1
- Application
-
Alternative Names
RALGPS1；KIAA0351；RALGEF2；Ras-specific guanine nucleotide-releasing factor RalGPS1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5JS13
-
Expression Region
1-305aa
-
AA Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM
-
Molecular Weight
50.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RALGPS1, a receptor-activated guanine nucleotide exchange factor, plays a pivotal role in intracellular signaling pathways, particularly in the regulation of the Ral protein, which is involved in cellular processes such as proliferation, differentiation, and survival. The study of RALGPS1 has garnered attention due to its potential implications in cancer biology, as altered Ral signaling has been linked to the progression of various tumors. Furthermore, RALGPS1 has been implicated in neurodevelopmental disorders, highlighting its significance beyond oncology. Researchers are particularly interested in understanding the structural and functional characteristics of RALGPS1, including its interaction with Ral and other signaling molecules. The manipulation of RALGPS1 activity could offer novel therapeutic strategies for diseases driven by aberrant signaling pathways. Therefore, the investigation of recombinant RALGPS1 proteins is crucial not only for elucidating the underlying mechanisms of these biological processes but also for identifying potential drug targets and biomarkers for disease diagnosis and treatment.
