Analytical Data
-
Gene name
GCP2
- Application
-
Alternative Names
GCP2；GCP2；Gamma-tubulin complex component 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04609
-
Expression Region
48-750aa
-
AA Sequence
EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
-
Molecular Weight
83.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GCP2, or Golgi Coiled-Coil Protein 2, is a member of the coiled-coil protein family that plays a vital role in the organization and function of the Golgi apparatus, which is essential for protein processing and trafficking within eukaryotic cells. Recent studies have highlighted GCP2's involvement in various cellular processes, including membrane dynamics, cellular signaling, and cytoskeletal organization. Its interaction with other Golgi-associated proteins underscores its significance in maintaining Golgi architecture and function. Abnormalities in GCP2 expression or function have been implicated in several diseases, including cancer and neurodegenerative disorders, making it a potential biomarker and therapeutic target. The recombinant expression of GCP2 provides a valuable tool for studying its structure-function relationships, enabling researchers to investigate its role in normal physiology and disease states. By producing GCP2 in a controlled system, scientists can explore its biochemical properties, binding interactions, and potential as a target for drug development. Moreover, understanding GCP2's mechanism may reveal novel insights into Golgi-related pathologies and pave the way for innovative therapeutic strategies. Given its critical role in cellular processes, ongoing research into GCP2 is expected to broaden our understanding of Golgi dynamics and its implications in health and disease.
