Analytical Data
-
Gene name
SELE
- Application
-
Alternative Names
SELE；P-selectin glycoProtein ligand 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16581
-
Expression Region
1-610aa
-
AA Sequence
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SELE, or selectin E, is a cell adhesion molecule that plays a pivotal role in leukocyte trafficking and inflammation. It is primarily expressed on endothelial cells and facilitates the rolling of leukocytes along the vascular endothelium during the immune response, thereby contributing to the recruitment of immune cells to sites of injury or infection. The study of SELE and its associated signaling pathways has garnered significant interest in recent years due to its implications in various pathological conditions, including autoimmune diseases, cardiovascular disorders, and cancer metastasis. Researchers have aimed to understand the structural and functional characteristics of SELE, as well as its interactions with other adhesion molecules and ligands. The investigation of SELE as a recombinant protein offers a valuable approach to decipher its role in cellular processes and to develop potential therapeutic strategies, including monoclonal antibodies or antagonist compounds. Furthermore, understanding the mechanisms governing SELE's function can lead to insights into designing targeted interventions to modulate inflammatory responses and improve clinical outcomes in patients with related diseases. Through recombinant DNA technology, scientists can produce and characterize SELE in a controlled environment, paving the way for detailed studies into its biophysical properties, binding kinetics, and functional assays, which are essential for future clinical applications.
