Analytical Data
-
Gene name
bglIIM
- Application
-
Alternative Names
bglIIM;Type II methyltransferase M.BglII
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q45489
-
Expression Region
1-360aa
-
AA Sequence
MSEDQYKQIKLHLGMEDDNEDLPNHIPSSFPKQHLNKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRPLEEYLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVWVRPHGLHANKKFAGRHETILWFTKTPEYKFFLDPIRVPQKYANKKHYKGDKKGELSGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGTTASVAKNLNRYFYGAEIEKEYVDIAYQILSGEPDENNNFPNLKTLRQYCEKNGIIDPSQYTFTRQRKGSKPSLDSKAHPEEHHKKEIVERIEFEAENSVYKKVQNEQ
-
Molecular Weight
58.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BglIIM is a recombinant protein derived from the bacterium Bacillus amyloliquefaciens, which is known for its ability to break down complex carbohydrates. Research on BglIIM has gained significant attention due to its potential applications in various fields, including biotechnology, food industry, and biofuel production. The enzyme is classified as a thermostable glycoside hydrolase, capable of hydrolyzing beta-glucosidic bonds in a wide range of substrates. This property makes it a valuable tool for enhancing the efficiency of biomass conversion processes, such as the production of fermentable sugars from agricultural waste materials. Furthermore, the study of BglIIM's structure and function can provide insights into enzyme mechanisms, making it a subject of interest in molecular biology. Investigating the expression and purification of BglIIM in recombinant systems can improve its availability and cost-effectiveness for industrial applications. Overall, the research into BglIIM not only contributes to fundamental knowledge in enzymology and microbiology but also holds promise for developing innovative solutions for sustainable resource management and alternative energy production.











