Analytical Data
-
Gene name
SEMA6D
- Application
-
Alternative Names
SEMA6D; KIAA1479; Semaphorin-6D
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NFY4
-
Expression Region
1-476 aa
-
AA Sequence
MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFADGKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYRLTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAK
-
Molecular Weight
80.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEMA6D, a member of the semaphorin family, plays a crucial role in regulating neuronal guidance, angiogenesis, and immune responses. This protein is particularly interesting due to its complex interactions with various receptors, including plexins and neuropilins, which mediate signaling pathways essential for development and tissue homeostasis. Research has indicated that SEMA6D may be implicated in several pathological conditions, such as cancer progression, neurodevelopmental disorders, and autoimmune diseases. Understanding its molecular mechanisms and the pathways it influences is vital for elucidating its role in these diseases. Recent studies have shown that SEMA6D may impact tumor microenvironments and immune cell interactions, making it a potential biomarker and therapeutic target. As researchers strive to uncover the full spectrum of SEMA6D's functions, the focus is also on its structure-function relationships that govern its biological activities. This pursuit not only enhances our knowledge of SEMA6D itself but also contributes to broader insights into the roles of semaphorins in various physiological and pathological processes, ultimately paving the way for innovative therapeutic strategies.
