Analytical Data
-
Gene name
SEMA4F
- Application
-
Alternative Names
SEMA4F; SEMAM; SEMAW; Semaphorin-4F; Semaphorin-M; Sema M; Semaphorin-W; Sema W
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95754
-
Expression Region
1-615 aa
-
AA Sequence
MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFPADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEPQPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAGEHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGAAHVVAAYSLVWGSQRDAPSRAHTVGAGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPSPEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI
-
Molecular Weight
93.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEMA4F (Semaphorin 4F) is a member of the semaphorin family, which are initially recognized for their roles in neural development and guidance. The interest in SEMA4F has expanded due to its involvement in various physiological and pathological processes beyond neurobiology, including immune responses, angiogenesis, and tumor progression. Researchers have identified SEMA4F as a crucial player in modulating cell interactions and signaling pathways. Its expression is noted in various tissues, influencing processes such as T-cell activation and tumor microenvironment modulation. Current studies focus on understanding the molecular mechanisms underlying SEMA4F's role in cancer biology and potential implications for targeted therapies. By exploring the structural and functional characteristics of SEMA4F through recombinant protein techniques, scientists aim to elucidate its signaling functions and therapeutic potential. This research is of particular interest due to the duality of SEMA4F's actions, which can promote or inhibit tumor growth depending on the cellular context, highlighting its potential as a therapeutic target in oncology and immune therapies.
