Analytical Data
-
Gene name
CKLFSF5
- Application
-
Alternative Names
CMTM5; CKLFSF5; CKLF-like MARVEL transmembrane domain-containing protein 5; Chemokine-like factor superfamily member 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DZ9
-
Expression Region
1-156aa
-
AA Sequence
MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
-
Molecular Weight
42.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CKLFSF5, a member of the C-terminal kinase-like family, has garnered significant attention in recent years due to its potential roles in various biological processes and disease states. This recombinant protein is implicated in cellular signaling pathways, particularly those related to inflammation, cancer, and neurodegeneration. Research suggests that CKLFSF5 may influence the regulation of gene expression and cellular responses to stress, making it a key player in maintaining cellular homeostasis. Studies have indicated that dysregulation of CKLFSF5 expression can contribute to the pathogenesis of several disorders, including cardiovascular diseases and cancer metastasis. Furthermore, CKLFSF5 is believed to interact with various protein partners, highlighting its potential as a target for therapeutic intervention. Techniques such as protein crystallography and mass spectrometry have been employed to elucidate its structure and function, providing insights into its mechanisms of action. Understanding the biological properties and interactions of CKLFSF5 is essential for developing novel strategies for diagnosing and treating diseases associated with its dysregulation. Overall, the exploration of CKLFSF5 as a recombinant protein paves the way for innovative research in molecular biology, with implications for both fundamental science and clinical applications.
