Analytical Data
-
Gene name
SEC22C
- Application
-
Alternative Names
SEC22C; SEC22L3; UNQ459/PRO784; Vesicle-trafficking protein SEC22c; SEC22 vesicle-trafficking protein homolog C; SEC22 vesicle-trafficking protein-like 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRL7
-
Expression Region
1-303 aa
-
AA Sequence
MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSDCGV
-
Molecular Weight
60.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEC22C, a member of the Sec22 family of proteins, plays a crucial role in intracellular membrane trafficking and vesicular transport, particularly in the context of protein secretion and recycling within the endoplasmic reticulum (ER) and Golgi apparatus. Research has indicated that SEC22C is involved in the transport of various proteins, including those essential for cell signaling and homeostasis. Mutations or dysregulation of SEC22C have been implicated in several diseases, including neurodegenerative disorders and cancer, highlighting its importance in cellular functions. Furthermore, SEC22C's interactions with other proteins and its involvement in the secretory pathway make it a significant target for therapeutic interventions. Understanding the structural and functional characteristics of SEC22C, as well as its regulatory mechanisms, could provide insights into its role in cellular physiology and the pathogenesis of diseases. Recent advances in molecular biology and structural biology techniques have enabled researchers to investigate SEC22C more thoroughly, paving the way for potential therapeutic strategies that could modulate its function. Studies focusing on the characterization of SEC22C, its binding partners, and its dynamic role within cellular compartments are essential for unraveling the complexities of protein trafficking and its implications in health and disease.
