Cat: PA1000-6995

Recombinant Human MSR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MSR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MSR1;SCARA1;Macrophage scavenger receptor types I and II

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P21757

  • Expression Region

    77-451aa

  • AA Sequence

    ADPKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEK RIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAI DEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVYNVS AEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQG PPGPPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYA GRPGNSGPKGQKGEKGSGNTLTPFTKVRLVGGSGPHEGRVEILHSGQWGT ICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGRE SSIEECKIRQWGTRACSHSEDAGVTCTLHHHHHH

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The MSR1 (macrophage scavenger receptor 1) is a crucial component in the immune response, primarily involved in the recognition and clearance of modified lipoproteins and apoptotic cells. It belongs to a class of receptors that play significant roles in the homeostasis of lipid metabolism and the modulation of inflammation. Research has revealed that MSR1 is implicated in various pathophysiological conditions, including atherosclerosis, Alzheimer's disease, and metabolic syndrome, largely due to its ability to influence macrophage activation and polarization. Understanding the structure and function of MSR1 can provide insights into its role in immune regulation and potential therapeutic targets. Recombining MSR1 as a recombinant protein facilitates detailed studies, enabling scientists to explore its binding properties, signaling pathways, and interactions with other cellular components. This research is essential for developing novel strategies to modulate receptor activity in disease contexts, thereby advancing potential treatments and improving therapeutic outcomes in immune-related disorders. Moreover, the investigation of MSR1's functional domains may uncover new mechanisms by which this receptor contributes to cellular responses, ultimately offering pathways for innovative biomedical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US