Cat: PA2000-3042

Recombinant Human GNA13 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GNA13

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GNA13;Guanine nucleotide-binding Protein subunit alpha-13

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14344

  • Expression Region

    1-377aa

  • AA Sequence

    MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVK ILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLV DAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIR ALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLAR RPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSS EFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAI NTENIRLVFRDVKDTILHDNLKQLMLQ

  • Molecular Weight

    67 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GNA13, a member of the Rho GTPase family, plays a crucial role in various cellular processes, including cytoskeletal dynamics, cell migration, and proliferation. Its function is vital in many physiological and pathological conditions, such as cardiovascular diseases and cancer. The study of GNA13 has garnered attention due to its involvement in signaling pathways that regulate cell shape and movement, especially its role in the activation of downstream effectors that modulate actin cytoskeleton organization. Research has revealed that aberrant regulation of GNA13 activity can lead to altered cellular behaviors, contributing to tumorigenesis and metastasis. This has prompted efforts to develop GNA13 as a potential therapeutic target. To further investigate its complex biological functions and interactions, researchers have utilized recombinant protein technology to produce GNA13 in sufficient quantities for detailed structural and functional studies. The reconstitution of GNA13 into cellular systems allows for the elucidation of its mechanisms of action and interactions with other proteins, ultimately enhancing our understanding of its role in health and disease. As our knowledge of GNA13 expands, it may provide new avenues for intervention in diseases where its pathways are dysregulated, underscoring the importance of continued research in this area.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US