Cat: PA1000-6854

Recombinant Human S100A5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    S100A5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    S100A5;S100D;Protein S100-A5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P33763

  • Expression Region

    1-92aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMETPLEKALTTMVTTFHKYSGREGSKLTLS RKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLC MAYNDFFLEDNK

  • Molecular Weight

    13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

S100A5 is a member of the S100 family of proteins, characterized by their calcium-binding properties and involvement in various cellular processes. It plays a crucial role in regulating cell cycle progression, differentiation, and apoptosis, and its expression is associated with several pathological conditions, including cancers and inflammatory diseases. Recent studies have highlighted S100A5 as a potential biomarker and therapeutic target due to its upregulation in certain tumors, indicating its involvement in tumorigenesis and cancer progression. The interest in recombinant S100A5 protein stems from its potential applications in understanding its role in these diseases, elucidating the molecular mechanisms underlying its functions, and exploring its potential as a target for novel therapeutic interventions. Recombinant S100A5 allows for the study of its biochemical properties, interactions with other proteins, and its physiological roles in a controlled environment, which can lead to insights into its mechanisms of action. Furthermore, understanding S100A5's interactions at the molecular level may pave the way for the development of S100A5-based diagnostic and therapeutic strategies. As research continues, S100A5's dual role in normal physiology versus disease pathology is likely to provide significant insights into both basic cellular function and potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US