Analytical Data
-
Gene name
FCY1
- Application
-
Alternative Names
FCY1；Cytosine deaminase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12178
-
Expression Region
1-158aa
-
AA Sequence
MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE
-
Molecular Weight
25.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FCY1, or the "Folate Cytosine Pyrimidine 1," is a key enzyme involved in the metabolism of folate and the synthesis of nucleotides. Folate, a B-vitamin, plays a crucial role in DNA synthesis, repair, and methylation, making FCY1 vital for cellular proliferation and function. Aberrations in folate metabolism have been linked to various health conditions, including certain cancers, neurological disorders, and developmental issues. The study of FCY1 recombinant protein has gained attention due to its potential therapeutic implications; engineered versions of the enzyme may provide insights into metabolic pathways and contribute to the development of targeted treatments. Advances in recombinant DNA technology allow for the efficient production of FCY1, enabling researchers to investigate its structure, function, and interactions with other biomolecules. By understanding the mechanistic role of FCY1 in folate metabolism, researchers aim to uncover new strategies for disease prevention and therapy, particularly in contexts where folate deficiency or dysfunction plays a significant role. Overall, the exploration of FCY1 recombinant protein represents a promising avenue for both fundamental research and clinical applications in the fields of biochemistry, molecular biology, and medicine.
