Analytical Data
-
Gene name
CGI-38
- Application
-
Alternative Names
CGI-38; p20; p25gamma; TPPP/p20; Tppp3; TPPP3_HUMAN; Tubulin polymerization-promoting Protein family member 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BW30
-
Expression Region
1-176aa
-
AA Sequence
MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
-
Molecular Weight
45.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CGI-38, a member of the proteins involved in lipid metabolism, has garnered significant attention in recent years due to its potential implications in metabolic disorders and cancer biology. Emerging research indicates that CGI-38 plays a critical role in regulating cellular lipid levels and influencing energy homeostasis. Its involvement in lipid droplet dynamics and interaction with various metabolic pathways highlights its importance in maintaining cellular function and overall metabolic health. Additionally, CGI-38 is believed to have a regulatory effect on inflammation and may participate in the pathophysiology of obesity-related diseases. Recent studies utilizing recombinant CGI-38 protein have aimed to elucidate its structure-function relationships, leading to insights into its mechanism of action at the molecular level. Understanding the biological activities of CGI-38 could ultimately pave the way for novel therapeutic targets for treating conditions associated with dysregulated lipid metabolism, such as non-alcoholic fatty liver disease (NAFLD) and certain types of cancer. As research continues to unfold, CGI-38 may offer promising avenues for intervention and further contribute to our understanding of metabolic health.
