Analytical Data
-
Gene name
FOLR2
- Application
-
Alternative Names
FOLR2；Folate receptor beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14207
-
Expression Region
19-230aa
-
AA Sequence
CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
-
Molecular Weight
27.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOLR2, or Folate Receptor 2, is a member of the folate receptor family that plays a crucial role in folate transport and cellular uptake, particularly in the context of cancer biology and development. Unlike its closely related counterpart FOLR1, FOLR2 is predominantly expressed in certain tissues, including the placenta and various tumors, making it a potential target for therapeutic strategies aimed at delivering drugs specifically to cancer cells. Research has shown that FOLR2 can be overexpressed in various malignancies, suggesting its involvement in tumor progression and metastasis. Consequently, the development of FOLR2 recombinant proteins has garnered interest for applications in drug targeting and immunotherapy. These recombinant proteins can be engineered to enhance targeting specificity and reduce off-target effects, potentially improving the efficacy of anticancer therapies. Furthermore, the study of FOLR2 also opens avenues for understanding the mechanisms of folate metabolism in tumor biology, which could lead to novel insights in cancer treatment. As such, ongoing research into FOLR2 recombinant proteins aims to elucidate their biological functions and explore their therapeutic potential, contributing to the advancement of targeted cancer therapies.
