Cat: PA2000-2998

Recombinant E.coli BLOT5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BLOT5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BLOT5;Mite allergen Blo t 5

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O96870

  • Expression Region

    1-134aa

  • AA Sequence

    MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

  • Molecular Weight

    31.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BLOT5 is a recombinant protein that has garnered attention in the field of molecular biology due to its potential applications in diagnostic and therapeutic contexts. Initially identified as a protein involved in immune response mechanisms, BLOT5 has been shown to play a critical role in the activation of immune cells, particularly T cells. Research on BLOT5 focuses on its structural properties and functional implications in immune signaling pathways, which may offer insights into autoimmune diseases and cancer treatment strategies. The ability to produce BLOT5 as a recombinant protein allows for detailed studies of its interactions with various ligands and receptors, enabling researchers to explore its biological functions more thoroughly. Moreover, generating BLOT5 in a recombinant form facilitates the development of novel diagnostic tools, potentially aiding in the early detection of immune-related disorders. As the scientific community seeks to understand the complexities of immune regulation, BLOT5 stands out as a promising candidate for further exploration, potentially leading to advancements in both basic research and clinical applications. Ongoing studies aim to elucidate its precise mechanisms of action, paving the way for innovative therapeutic interventions that harness the power of the immune system in combating diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US