Analytical Data
-
Gene name
PRSS2
- Application
-
Alternative Names
PRSS2；TRY2；TRYP2；Trypsin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07478
-
Expression Region
16-247aa
-
AA Sequence
APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
-
Molecular Weight
52.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRSS2 (Protease, Serine 2) is a serine protease that plays a critical role in various physiological processes, including digestion and immune response. Its significance has gained attention particularly in the context of viral infections, such as those caused by coronaviruses. Research has shown that PRSS2 is involved in the activation of certain viral proteases, facilitating the entry of viruses into host cells. The enzyme's expression is particularly pronounced in tissues like the pancreas and lungs, which are also primary sites of infection for some respiratory viruses. Studies have focused on the recombinant production of PRSS2 protein to explore its structural and functional properties, aiming to understand its mechanistic role in viral pathogenesis. Recombinant PRSS2 can be used in various assays to investigate its interactions with viral proteins and to evaluate potential inhibitors that could mitigate viral entry and infection. Additionally, understanding the enzyme's activity can provide insights into therapeutic strategies for diseases associated with aberrant protease activity, including certain types of cancer and pancreatitis. Overall, research on PRSS2 recombinant protein is crucial for elucidating its biological functions and therapeutic potentials, particularly in combating viral diseases and improving human health.
