Analytical Data
-
Gene name
SAMD8
- Application
-
Alternative Names
SAMD8; Sphingomyelin synthase-related protein 1; SMSr; Ceramide phosphoethanolamine synthase; CPE synthase; Sterile alpha motif domain-containing protein 8; SAM domain-containing protein 8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LT4
-
Expression Region
1-326 aa
-
AA Sequence
MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTECKYLFSASMRIR
-
Molecular Weight
64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SAMD8, or Sterile Alpha Motif Domain 8, is a protein that has garnered significant attention in recent years due to its potential involvement in various biological processes, including cellular signaling, apoptosis, and immune responses. This protein is characterized by the presence of a SAM domain, which is known to facilitate protein-protein interactions, suggesting that SAMD8 may play a critical role in the assembly of protein complexes and the regulation of cellular functions. Recent studies have indicated that SAMD8 may also be implicated in disease mechanisms such as cancer, whereby its expression levels influence tumor progression and metastasis. Understanding the molecular functions and regulatory mechanisms of SAMD8 is essential for elucidating its role in health and disease. To further explore the biological functions of SAMD8, researchers have been developing recombinant forms of the protein. The production of SAMD8 recombinant protein allows for detailed biochemical analyses, structural studies, and the exploration of its interaction with other cellular components. By utilizing techniques such as protein expression in heterologous systems, purification, and functional assays, scientists aim to uncover the precise roles that SAMD8 plays in various cellular contexts. This research could lead to novel therapeutic strategies targeting SAMD8 in diseases where its function is dysregulated, ultimately providing insights into potential interventions for conditions such as cancer and immune disorders.
