Analytical Data
-
Gene name
CEBPE
- Application
-
Alternative Names
C/EBP epsilon; CCAAT/enhancer binding Protein (C/EBP) epsilon; CCAAT/enhancer binding Protein epsilon; CCAAT/enhancer-binding Protein epsilon; CEBPE; CEBPE_HUMAN; CRP 1; CRP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15744
-
Expression Region
1-281aa
-
AA Sequence
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
-
Molecular Weight
56.65 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEBPE, or CCAAT/enhancer-binding protein epsilon, is a transcription factor that plays a crucial role in myelopoiesis and the differentiation of hematopoietic cells. It is a member of the C/EBP family and is primarily involved in the regulation of genes associated with immune responses and myeloid lineage development. Research into CEBPE has gained significance due to its association with various hematological disorders, including chronic myeloid leukemia and acute myeloid leukemia, where its expression levels can affect disease progression and prognosis. Understanding the structure and function of CEBPE through recombinant protein studies is paramount for dissecting its mechanisms of action and potential as a therapeutic target. Recombinant CEBPE can be produced to facilitate in vitro studies, enabling researchers to analyze its binding properties, post-translational modifications, and interactions with other proteins and DNA. Furthermore, investigating the downstream effects of CEBPE activation can provide insights into its role in immune system regulation and its implications in diseases. This research not only expands the fundamental knowledge of transcriptional regulation within the hematopoietic system but also holds promise for developing novel diagnostic and therapeutic strategies for related pathologies. As such, CEBPE recombinant protein studies represent an essential area of investigation in molecular biology and hematology, offering potential pathways to innovative medical advances.
