Analytical Data
-
Gene name
agn1
- Application
-
Alternative Names
agn1；Glucan endo-1.3-alpha-glucosidase agn1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O13716
-
Expression Region
21-424aa
-
AA Sequence
DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRPTPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSGVPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTGVLYF
-
Molecular Weight
51.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Agn1 is a crucial protein involved in the biosynthesis of the plant hormone auxin, specifically in the synthesis of indole-3-acetic acid (IAA), which plays a pivotal role in various plant growth and development processes. The understanding of Agn1's structure and function has gained significant attention due to its implications in agricultural biotechnology and plant science. Research into Agn1 has illuminated its role in regulating cell elongation, root and shoot development, and response to environmental stimuli. Studies have shown that mutations in the Agn1 gene can lead to altered auxin levels, ultimately affecting plant morphology and physiology. As auxin serves as a key regulator in processes such as apical dominance, tropisms, and fruit development, Agn1's function is vital for optimizing crop yields and enhancing stress resistance in plants. The recombinant production of Agn1 protein allows for in-depth functional analysis, enabling scientists to explore its enzymatic activity, interaction with other proteins, and its regulatory networks within the auxin biosynthesis pathway. This research not only contributes to the fundamental understanding of plant biology but also holds promise for engineering crops with improved traits, thereby addressing global food security challenges.
