Analytical Data
-
Gene name
SAA4
- Application
-
Alternative Names
SAA4；CSAA；Serum amyloid A-4 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35542
-
Expression Region
19-130aa
-
AA Sequence
ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPG GVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDP DRFRPDGLPKKY
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SAA4, or Serum Amyloid A4, is a protein that belongs to the serum amyloid A (SAA) family, which plays a critical role in the acute phase response to inflammation. This protein is primarily produced by the liver and is involved in various physiological processes, including lipid metabolism, immune response, and tissue repair. The SAA proteins, particularly SAA1 and SAA2, have been extensively studied due to their association with inflammatory diseases and amyloidosis. However, SAA4 has garnered attention as its function and clinical relevance remain less understood. Recent research has indicated that SAA4 may have protective roles in certain inflammatory conditions, and its expression patterns can vary in different tissues and disease states. Understanding the molecular mechanisms and biological pathways involving SAA4 could provide insights into its potential role in inflammatory diseases, cardiovascular health, and potential therapeutic applications. Moreover, the development of recombinant SAA4 protein may facilitate further studies to elucidate its functional properties and interactions within the immune system, potentially leading to novel biomarker development and therapeutic strategies targeting inflammation-related disorders. Overall, exploring SAA4's biochemical characteristics and functional implications is crucial for advancing our understanding of its impact on human health and disease.
