Analytical Data
-
Gene name
Dbil5
- Application
-
Alternative Names
Dbil5;Diazepam-binding inhibitor-like 5
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O09035
-
Expression Region
1-87aa
-
AA Sequence
MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC
-
Molecular Weight
13.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dbil5 is a protein derived from the enzyme Dbh (dibasic amino acid decarboxylase), which has garnered significant attention in biomedical research due to its potential applications in understanding metabolic pathways and addressing various diseases. The importance of Dbil5 lies in its role in the decarboxylation of amino acids, which is crucial for synthesizing neurotransmitters and regulating physiological processes. Recent studies have focused on its structure, function, and the implications of its activity in metabolic disorders and neurological diseases. The recombinant expression of Dbil5 allows researchers to obtain large quantities of the protein for detailed biochemical analyses and functional assays. This, in turn, aids in elucidating the mechanistic pathways through which amino acid metabolism influences cellular functions. Investigating the properties and interactions of recombinant Dbil5 can provide insights into developing novel therapeutic strategies for conditions linked to amino acid imbalances, such as depression, obesity, and other metabolic syndromes. As research progresses, the characterization of Dbil5 and its derivatives aims to pave the way for innovative approaches in pharmacology and biotechnology, enhancing our understanding of human health and disease.











